PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G056600.1.p
Common NameLOC101759880, SETIT_007889mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 318aa    MW: 35111.4 Da    PI: 7.0966
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G056600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-12143186447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         WT+ E+ l++++ + +G g+Wk+I++++ ++Rt+ q+ s+ qky
  Seita.4G056600.1.p 143 WTKAEHRLFLRGLQVYGRGNWKSISKYFVTTRTPMQVSSHAQKY 186
                         *******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.733135191IPR017930Myb domain
SMARTSM007175.5E-11139189IPR001005SANT/Myb domain
SuperFamilySSF466892.44E-16140192IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-13142189IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-10142188IPR009057Homeodomain-like
CDDcd001673.88E-10143187No hitNo description
PfamPF002493.6E-10143186IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MDSTKSNGEW SASEINMVKS LIARYNANNS YADDMNKKHD NIVNEIQAMF PMKEKHQAIS  60
LYVDLVVQMM QSGTGDGSVQ HSVAASGDLV SNNFEIQVED PPMDNMDMLL GYPTMDIGAL  120
RVAREVPRRQ PTPRMARLHT RFWTKAEHRL FLRGLQVYGR GNWKSISKYF VTTRTPMQVS  180
SHAQKYFKRL KNAARRQRYS INDVGLYDAE PSVQNNTSSW EGLTFTKGAY ATPSPYGASG  240
QHATMNNVAQ VRSPILNHAS HAGTSNQAAA GAGDQQMGTT SSYVAPMTEG DGGLQEALAG  300
DHLGDFLDDL MMNMDIF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966689.10.0PREDICTED: uncharacterized protein LOC101759880
TrEMBLK3Y1270.0K3Y127_SETIT; Uncharacterized protein
STRINGSi007889m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10580.25e-22MYB_related family protein